2011•Chinese Journal of Natural MedicinesRequires access
A Novel Bioactive Peptide with Myotropic Activity from Wasp Venoms
Yan Hong
Open publisher page 0 citations
Abstract
AIM:To study the chemical constituents of the venom of Vespa bicolor Fabricius collected from Shanxi Province,China.METHODS:Gel chromatography and HPLC were applied to isolate a peptide from the venom.Mass spectrometry and Edman degradation were used for its structural characterization.The cDNA encoding vespin-BF precursor was cloned from the cDNA library of the venomous glands.The synthetic peptide was used for its bioassay.RESULTS:A novel bioactive peptide(vespin-BF) with unique primary structure was purified and characterized.Its amino acid sequence was determined as TYQRKMAITAGAVKHRLMSTTIIIILVRIE YLRDNMVISLESSF.Vespin-BF induced contraction of isolated ileum smooth muscle.The precursor is composed of 67 amino acid residues including the predicted signal peptide and mature vespin-BF.A di-basic enzymatic processing site(-KR-) was located between the signal and the mature peptide.BLAST search indicated that vespin-BF shows obvious similarity to vespin identified from the venoms of Vespa magnifica.CONCLUSION:A novel bioactive peptide from the wasp venoms was characterized.